Loading [MathJax]/jax/output/SVG/jax.js
Research article

A new distributional approach: estimation, Monte Carlo simulation and applications to the biomedical data sets

  • Received: 18 May 2023 Revised: 18 July 2023 Accepted: 21 July 2023 Published: 22 August 2023
  • This paper introduces the generalized exponential-U family of distributions as a novel methodological approach to enhance the distributional flexibility of existing classical and modified distributions. The new family is derived by combining the T-X family method with the exponential model. The paper presents the generalized exponential-Weibull model, an updated version of the Weibull model. Estimators and heavy-tailed characteristics of the proposed method are derived. The new model is applied to three healthcare data sets, including COVID-19 patient survival times and mortality rate data set from Mexico and Holland. The proposed model outperforms other models in terms of analyzing healthcare data sets by evaluating the best model selection measures. The findings suggest that the proposed model holds promise for broader utilization in the area of predicting and modeling healthcare phenomena.

    Citation: Mustafa Kamal, Meshayil M. Alsolmi, Nayabuddin, Aned Al Mutairi, Eslam Hussam, Manahil SidAhmed Mustafa, Said G. Nassr. A new distributional approach: estimation, Monte Carlo simulation and applications to the biomedical data sets[J]. Networks and Heterogeneous Media, 2023, 18(4): 1575-1599. doi: 10.3934/nhm.2023069

    Related Papers:

    [1] Tiago A. da Fonseca, Felipe S. Quintino, Luan C. S. M. Ozelim, Pushpa N. Rathie . Estimation of P(X<Y) for Fréchet, reversed Weibull and Weibull distributions: Analytical expressions, simulations and applications. Networks and Heterogeneous Media, 2024, 19(4): 1424-1447. doi: 10.3934/nhm.2024061
    [2] Olli-Pekka Tossavainen, Daniel B. Work . Markov Chain Monte Carlo based inverse modeling of traffic flows using GPS data. Networks and Heterogeneous Media, 2013, 8(3): 803-824. doi: 10.3934/nhm.2013.8.803
    [3] Pierre Degond, Hailiang Liu . Kinetic models for polymers with inertial effects. Networks and Heterogeneous Media, 2009, 4(4): 625-647. doi: 10.3934/nhm.2009.4.625
    [4] Victor Berdichevsky . Distribution of minimum values of stochastic functionals. Networks and Heterogeneous Media, 2008, 3(3): 437-460. doi: 10.3934/nhm.2008.3.437
    [5] Reuven Cohen, Mira Gonen, Avishai Wool . Bounding the bias of tree-like sampling in IP topologies. Networks and Heterogeneous Media, 2008, 3(2): 323-332. doi: 10.3934/nhm.2008.3.323
    [6] Roberto Serra, Marco Villani, Alex Graudenzi, Annamaria Colacci, Stuart A. Kauffman . The simulation of gene knock-out in scale-free random Boolean models of genetic networks. Networks and Heterogeneous Media, 2008, 3(2): 333-343. doi: 10.3934/nhm.2008.3.333
    [7] Fabio Della Rossa, Carlo D’Angelo, Alfio Quarteroni . A distributed model of traffic flows on extended regions. Networks and Heterogeneous Media, 2010, 5(3): 525-544. doi: 10.3934/nhm.2010.5.525
    [8] Tingfu Yao, Changlun Ye, Xianbing Luo, Shuwen Xiang . A variational MAX ensemble numerical algorism for a transient heat model with random inputs. Networks and Heterogeneous Media, 2024, 19(3): 1013-1037. doi: 10.3934/nhm.2024045
    [9] Claudio Canuto, Anna Cattani . The derivation of continuum limits of neuronal networks with gap-junction couplings. Networks and Heterogeneous Media, 2014, 9(1): 111-133. doi: 10.3934/nhm.2014.9.111
    [10] Caterina Balzotti, Maya Briani, Benedetto Piccoli . Emissions minimization on road networks via Generic Second Order Models. Networks and Heterogeneous Media, 2023, 18(2): 694-722. doi: 10.3934/nhm.2023030
  • This paper introduces the generalized exponential-U family of distributions as a novel methodological approach to enhance the distributional flexibility of existing classical and modified distributions. The new family is derived by combining the T-X family method with the exponential model. The paper presents the generalized exponential-Weibull model, an updated version of the Weibull model. Estimators and heavy-tailed characteristics of the proposed method are derived. The new model is applied to three healthcare data sets, including COVID-19 patient survival times and mortality rate data set from Mexico and Holland. The proposed model outperforms other models in terms of analyzing healthcare data sets by evaluating the best model selection measures. The findings suggest that the proposed model holds promise for broader utilization in the area of predicting and modeling healthcare phenomena.



    Andersen–Tawil syndrome (ATS) [1,2] is a disease characterized by: skeletal abnormalities, periodic muscle paralysis and the presence of specific ventricular arrhythmias that may predispose to sudden cardiac death. Some afflicted individuals had characteristic developmental abnormalities and might possess distinctive physical features, such as scoliosis, low-set or malformed ears, short stature, orbital hypertelorism; i.e., an increased distance between the eyes, a broad forehead, micrognathia, small hands and feet, and loose joints. ATS is considered as a rare hereditary multisystem disorder, which is also known as long QT syndrome type 7 (LQT7) [3]. This syndrome has an estimated prevalence of approximately 1/1,000,000 [4,5]. Although the genetic basis of this disease in 40% of cases is unknown, more than 60% of the identified cases of this rare genetic disease are associated with mutations in the KCNJ2 gene [6], which encodes an inward rectifier potassium channel 2, Kir2.1 protein. The predominant form of this channelopathy is sporadic or non-hereditary, which means that at least 30% of the syndrome-associated mutations in the KCNJ2 gene are de novo [7,8,9,10,11], but ATS can also be inherited in an autosomal dominant fashion [8,10].

    The Kir2.1 protein produces a strong inward rectification, preferentially passing potassium ions into the cell. It belongs to the Kir family of potassium channels and, being preferentially expressed in the heart and nervous tissues, is involved in stabilizing the resting membrane potential [12]. Topologically, human Kir2.1 protein (UniProt ID: P63252) is characterized by the presence of two α-helical transmembrane regions (M1 and M2, residues 82–106 and 157–178) separated by a regulatory segment (residues 107–156) containing the intramembrane pore-forming loop (H5 or P-loop, residues 129–147) connected to the M1 and M2 transmembrane regions via extracellular linkers (residues 107–128 and 148–156). The N- and C-terminal regions of this protein (residues 2–81 and 179–427, respectively) are located intracellularly. The active channels are formed by heterotetramerization or homotetramerization of four Kir2.x subunits to form a tetramer [12]. The K+ selectivity of the Kir2.1 channel is determined by its intramembrane pore-forming loop containing the G–Y–G (Gly-Tyr-Gly) signature sequence [12]. The vast majority of the Kir2.1 mutations associated with ATS are loss-of-function mutations located within the N- and C-terminal tails of this protein [13]. In fact, from the 66 mutations described in the literature so far [13], which include missense mutations (58 mutations of 36 different residues), short deletions, nonsense mutations and an insertion, 15 and 34 mutations are found within the N- and C-terminal regions, respectively, of the Kir2.1 protein. However, other parts of this protein are also affected by the ATS-associated mutations, with M1, P-loop, and M2 containing 6, 8 and 3 such mutations, respectively [13].

    In this work, we aim to contribute, from a computational viewpoint, to a better understanding of the 16 ATS mutated proteins extracted from the UniProt database on September 2017 [UniProt ID: P63252-01—P63252-17]—these 16 redundant proteins—it means that one protein (variant) can appear several times, equivalent to 13 non-redundant mutated proteins (Table 1)—by training a computational system, the Polarity Index Method® (PIM) [14], with the ATS mutated proteins taken from the UniProt database [15]. The PIM profile obtained from the PIM system in this study was compared to the PIM profile of mutated proteins associated with Brugada syndrome (BrS) [16] (since BrS and ATS are both channelopathies, where these BrS-related mutations affect the sodium channel, while the ATS-related mutation affect the potassium channel), and with the PIM profiles of the antimicrobial proteins associated with bacteria (Gram–positive/Gram–negative), fungi, viruses, and cancer, whose sequences were extracted from the UniProt and APD3 [17] databases. The ATS mutated proteins were also compared with the Cell-Penetrating Peptides (CPP) with and without endocytic uptake mechanism from the CPPsite database [18] and with proteins containing different levels of intrinsic disorder, such as completely disordered and partially disordered [19] (see Table 1).

    Table 1.  Protein sets.
    # Source Access date Groups Debugging process aATS bIntrinsic disorder propensity cCPP
    Redundant sequences in PIM format Non-redundant sequences in PIM format Mutated proteins Completely disordered Partially ordered With endocytic uptake mechanism Without endocytic uptake mechanism
    1 UniProt [15] Sep 5th, 2017 ATS proteins 8 7 0 6@ 3@ 0Σ 0Σ
    2 UniProt [15] Sep 5th, 2017 ATS mutated proteins 16 13 13 10@ 1@ 0Σ 0Σ
    3 UniProt [15] Sep 5th, 2017 BrS proteins 36 20 0 15 12 0 1
    4 UniProt [15] Sep 5th, 2017 BrS mutated proteins 4388 824 0 664 505 0 5
    5 APD3 [17] Aug 16th, 2017 Peptides associated to bacteria 1117 975 0 519 590 249 105
    6 APD3 [17] Aug 16th, 2017 Peptides associated to fungi 283 269 0 125 117 28 11
    7 APD3 [17] Aug 16th, 2017 Peptides associated to virus 44 44 0 22 22 5 1
    8 APD3 [17] Aug 16th, 2017 Peptides associated to cancer 23 22 0 13 12 2 1
    9 UniProt [15] Sep 5th, 2017 Peptides associated to bacteria 658 581 0 299 279 69 26
    10 UniProt [15] Sep 5th, 2017 Peptides associated to fungi 20 20 0 16 9 0 0
    11 UniProt [15] Sep 5th, 2017 Peptides associated to virus 93 93 0 60 37 0 0
    12 UniProt [15] Sep 5th, 2017 Peptides associated to cancer 206 204 0 28 18 0 0
    13 [19] Completely disordered proteins 106 50 0 46 18 2 0
    14 [19] Partially ordered proteins 152 149 0† 56 132 9 2
    15 CPPsite [18] Oct 30th, 2017 CPP with endocytic uptake mechanism 100 86 0 35 52 83 39
    16 CPPsite [18] Oct 30th, 2017 CPP without endocytic uptake mechanism 126 105 0 20 43 26 62
    17 UniProt [15] Sep 5th, 2017 Gram–positive bacteria "reviewed" proteins 6720 6582 0 4133 2980 116 60
    18 UniProt [15] Sep 5th, 2017 Gram–positive bacteria "non-reviewed" proteins 35304 32692 0 22333 7994 142 109
    19 UniProt [15] Sep 5th, 2017 Gram–negative bacteria "reviewed" proteins 2076 1782 0 1107 891 66 27
    20 UniProt [15] Sep 5th, 2017 Gram–negative bacteria "non-reviewed" proteins 142692 123683 1 99841 68286 543 394
    21 APD3 [17] Sep 5th, 2017 Gram–positive bacteria proteins 472 408 0 235 249 73 24
    22 APD3 [17] Sep 5th, 2017 Gram–negative bacteria proteins 256 232 0 122 131 53 32
    23 UniProt [15] Sep 5th, 2017 All "reviewed" proteins found in humans 9023 8975 1Ω N/P N/P N/P N/P
    24 UniProt [15] Sep 5th, 2017 All "reviewed" proteins in living organisms 558114 468939 11Ω N/P N/P N/P N/P
    Number of a, b, cproteins (located in columns) found in each of the 24 protein (located in rows) groups, when it was calibrated the PIM system with whose protein sets. PIM format: numeric substitution of each amino acid from the linear sequence according to its polarity [P+, P, N, NP] (2.1 PIM profile algorithm section). N/P: Item not processed. See analysis Ω, , , @, Σ in 3 Results section.

     | Show Table
    DownLoad: CSV

    Then, from the UniProt database [http://www.UniProt.org/help/retrieve_sets], we extracted 9,023 "reviewed" human proteins (September 5th, 2017), and 468,939 "reviewed" proteins found in other living organisms, and calculated their PIM profiles. Next, the PIM profile of each of these proteins were compared with the PIM profile obtained for ATS mutated proteins. The PIM system was able to identify and discriminate, with a high level of certainty (90%), the ATS-mutated proteins from the other protein groups analyzed in this study. This selection of protein sets aims to validate the discriminative capacity of the PIM profile metric, to then use the PP characteristic of ATS mutated proteins, and look among other protein groups for proteins with the same PIM profile. We hypothesize that proteins with similar PIM profiles should have similar functions.

    The efficiency of the PIM system was verified by comparison of the proportion of accepted/rejected proteins from two comparisons: first, the ATS mutated proteins and BrS mutated proteins with respect to the real proportion of corresponding proteins in those groups; and second, from the ATS mutated proteins and ATS proteins with respect to the real proportion of corresponding proteins in those groups. These analyses were performed using the nonparametric two-sided Kolmogorov–Smirnov test (2.6 Statistical test section).

    The PIM system [14] has been used to identify several protein groups in previous studies. However, we consider it appropriate to describe it in this work (see 2.1 PIM profile algorithm section).

    The metric of the PIM profile used by the computational PIM system extensively evaluates the 16 interactions observed when reading the linear sequence of a protein by pairs of residues, amino acid by amino acid, from left to right. The system initially replaces the amino acid sequence with the corresponding numeric charge-related annotations {P+, P, N, NP} = {1, 2, 3, 4}, according to this rule: P+ (polar positively charged) = {H, K, R}; P (polar negatively charged) = {D, E}; N (polar neutral) = {C, G, N, Q, S, T, Y} and NP (non-polar) = {A, F, I, L, M, P, V, W}. The 16 possible incidences are recorded in a 4 × 4 algebraic matrix, or incidence matrix, whose rows and columns represent these four groups, then the matrix is normalized. The last step is to create a 16-element vector, placing, from left to right, the position (16 possible positions), in decreasing order taken from the incidence matrix. This vector constitutes the fingerprint of the group of proteins evaluated.

    To exemplify this procedure, we take an arbitrary protein [GWKDWAKKAGGWLKKKGPGMAKAALKAAMQ] (30 amino acids), according to the corresponding numeric charge-related annotations, its equivalent is: [341244114334411134344144414443]; that is equivalent in numeric pairs —read from left to right— to [34, 41, 12, 24, 44, 41, 11, 14, 43, 33, 34, 44, 41, 11, 11, 13, 34, 43, 34, 44, 41, 14, 44, 44, 41, 14, 44, 44, and 43] (29 pairs), and its corresponding incidence matrix is shown in (Table 2, A-Step). This incidence matrix is normalized –to appreciate the order (Table 2, B-Step), and it represents its 16 positions as 16-element vector in increasing order (Table 2, C-Step). The elements of the 16-element vector are assigned, placing in its element 1, the position of the matrix A which has the higher frequency, to element 2, the position of the matrix A which has the next frequency with lower value, and so on until, to assign to the last element of the vector the position of the matrix A with the lower frequency.

    Table 2.  Example.
    A-Step: Incidence matrix–adding.
    P+ P N NP
    P+ 3pos 1 (6) 1pos 2 (10) 1pos 3 (9) 3pos 4 (5)
    AGWKDWAKKAGGWLKKKGPGMAKAALKAAMQ [i, j] = P 0 pos 5 (16) 0pos 6 (15) 0 pos 7 (14) 1pos 8 (8)
    N 0pos 9 (13) 0pos (10) (12) 1pos 11 (7) 4pos 12 (3)
    NP 5pos 13 (2) 0pos 14 (11) 3pos 15 (4) 7pos 16 (1)
    P+ P N NP
    B-Step Incidence matrix–weighting.
    P+ P N NP
    P+ 0.100pos 1 (6) 0.033pos 2 (10 0.0333pos 3 (9) 0.100pos 4 (5)
    AGWKDWAKKAGGWLKKKGPGMAKAALKAAMQ [i, j] = P 0.000 pos 5 (16) 0.000pos 6 (15) 0.0000pos 7 (14) 0.033pos 8 (8)
    N 0.000pos 9 (13) 0.000pos (10) (12) 0.0333pos 11 (7) 0.133pos 12 (3)
    NP 0.166pos 13 (2) 0.000pos 14 (11) 0.1000pos 15 (4) 0.233pos 16 (1)
    C-Step: Incidence matrix–comparison.
    Position 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16
    aA [i, j] 16 13 12 15 4 1 11 8 3 2 14 10 9 7 6 5
    b Target [i, j] 16 11 8 6 7 15 12 10 14 5 4 13 9 1 3 2
    Similarity x
    Similarities 1 2
    A-Step: Number of incidences (in pairs of amino acids) found in the protein GWKDWAKKAGGWLKKKG PGMAKAALKAAMQ. B-Step: Weighting the incidence matrix. C-Step: Comparison of asample protein and btarget protein by position. (✔): The position matches in the matrices. (✕): The position does not match in the matrices (2.1 PIM profile algorithm section). In this example, the similarity of asample protein respect to btarget protein occurs in positions: 1, and 13 ➡ 2/16 = 12.4%. Note [A-Step and B-step]: Pos 16 (1) means that at position 16 of matrix A, the highest frequency is found, and placed at position 1 of the vector. Pos 5 (16) means that in position 5 of matrix A, the lowest frequency is found, and is placed at position 16 of the vector. In case of two or more equal frequency values, the matrix A is read from bottom to top and from right to left of the matrix.

     | Show Table
    DownLoad: CSV

    Note: In case of two or more equal frequencies in matrix A, it is read from bottom to top, and from left to right.

    The comparison of the PIM profile of a protein, with a target protein—which we will assume is representative of the searched characteristic (Table 2, C-Step), is done by comparing the their 16-element vectors. In summary, the PIM system establishes that if two proteins have similar PIM profile 14 out of 16 (Table 2, C-step), then both proteins have the same preponderant function.

    We provide a workflow of the PIM system (Figure 1), in order to clarify the procedure of this non-supervised computational system.

    Figure 1.  Workflow of evaluation of proteins under study by the PIM system (2.1 PIM profile algorithm section).

    The incidence matrices of the ATS mutated proteins and ATS mutated proteins (Figure 2.a) and BrS mutated proteins versus ATS proteins (Figure 2.b) are represented geometrically as histograms, since the interactions are expressed as a discrete range, i.e. 16 interactions are mentioned in the X-axis.

    Figure 2.  PIM profile of ATS (mutated) proteins versus aATS proteins. PIM profile ATS (mutated) proteins and bBrS (mutated) proteins. The X-axis represents the 16 interactions (2.2 Graphics of PIM profile section).

    A selected group of proteins identified by the PIM system (see 2.4 Test plan section) was graphically analyzed, compared only by its differences, with respect to the PIM profile of the ATS mutated proteins group (Figure 3).

    Figure 3.  Proximity of the proteins: A3NDB2, A3NZ22, A1V0A6, Q62H74, A2S5D5, and A3MPB8 (2.4 Test plan section), to the ATS mutated protein group.

    The procedure for obtaining this selected protein group consisted in calculating the PIM profile of each protein and comparing it with the PIM profile of ATS mutated proteins. We accepted all candidate proteins, whose distance, with respect to each interaction, was less than 1%; i.e., |ATSi – Candidate proteini| < 0.01, where i = 1, ..., 16 interactions (see 2.1 PIM Profile algorithm section). After that, we graphically compared proteins in this set with each other (see Supplementary Materials). The proteins accepted analytically and graphically can be seen in (Figure 3).

    The proteins associated with ATS and Brugada syndrome were extracted from the UniProt database (Table 1), and the mutated proteins associated with each of these syndromes were extracted using the Swissknife–SourceForge® software. Note that although 66 ATS-related mutated proteins are described for the Kir2.1 protein in the literature [13], UniProt has information for only about 16 such redundant mutated proteins [UniProt ID: P63252-01 — P63252-17] — equivalent to 13 not non-redundant proteins (see Table 1). Therefore, our analysis was limited to mutated proteins annotated in UniProt, and there were tested with the proteins associated with bacteria (Gram–positive/Gram–negative), fungi, viruses, and cancer were extracted from the UniProt and APD3 databases (Table 1, rows). The CPP with, and without endocytic uptake mechanism, were extracted from the CPPsite database. The different disorder propensity of protein groups —completely disordered and partially ordered— were extracted from Table 1 [20]. From UniProt database we extracted all "reviewed" proteins found in humans, and all "reviewed" proteins found in living organisms (Table 1, rows). Part of the bioinformatics analysis was based on the proteins mostly classified as "reviewed", extracted from the UniProt database (Table 1). Since the databases are constantly updated, the website and date of extraction of each group are stated in Table 1.

    In order to identify the coincidences between the graphs, the relative frequencies of the proteins and mutated proteins associated with ATS were geometrically compared using histograms as geometric representation (Figure 2). The PIM system was calibrated with the following groups: ATS mutated proteins, CPP with, and without endocytic uptake mechanism, and intrinsically disordered proteins: completely disordered and partially ordered (Table 1, 6 columns), searching each PIM profile among the aforementioned groups (Table 1, 24 rows). Finally, the PIM system was calibrated with the ATS mutated proteins looking for coincidences in the PIM profile among the 468939 "reviewed" proteins found in living organisms (Table 1, Ω box), and 9023 "reviewed" proteins found in humans (Table 1, Ω box) from the UniProt database. The identified proteins in the previous step (Table 3, row 4) were compared (2.2 Graphics of PIM profile section) graphically (Figure 3) with the representative PIM profile of the ATS mutated proteins.

    Table 3.  ATS mutation protein candidates.
    # aProtein groups bSimilar sequences found in UniProt database
    1 Partially ordered proteins from Oldfield's work, 2005 [19] P19793
    2 Gram–negative bacteria "non-reviewed" protein from UniProt database A0A0F4RG51
    3 All "reviewed" proteins found in humans from UniProt database Q9NZV8
    4 All "reviewed" proteins found in living organisms from UniProt database A0AFU8, B1JIG7, Q66DY2, B2K6Q9, A7FLH5, Q3YYT6, Q31XQ5 B2TYK2, B6I5F4, P68066, B1IVP8, A8A391, B1XBQ6, C4ZYK2, B7M8J4, B7MYL2, B5Z153, P68067, B7LDH2, A7ZQ24, A4IYJ6, Q5NFR4, A0Q713, B2SGC2, Q14H66, A1WUH1, Q28S09, A3NDB2, A3NZ22, A1V0A6, Q62H74, A2S5D5, A3MPB8, Q4ZNN4, O72736, L0G8Z0, Q0GNN1.
    aProteins identified by PIM system with similar PIM profile to ATS mutated protein group. b100% of similarity according to UniProt database. Uniprot IDs in bold have very similar PIM profile to ATS mutated proteins (2.4 Test plan section).

     | Show Table
    DownLoad: CSV

    The intrinsic disorder predisposition of the human Kir2.1 protein (UniProt ID: P63252) was evaluated using the D2P2 platform, which is a database of predicted disorder that represents a community resource for pre-computed disorder predictions on a large library of proteins from completely sequenced genomes [21]. In addition to showing the outputs of several disorder predictors, such as PONDR® VLXT, PONDR® VSL2B, IUPred, PrDOS, ESpritz and PV2, for a given query protein, the D2P2 database also provides information on the curated sites of various posttranslational modifications and on the location of predicted disorder-based potential binding sites (MoRF) [22] (Figure 4).

    Figure 4.  Evaluation of the functional intrinsic disorder propensity of human Kir2.1 protein (UniProt ID: P63252) by D2P2 database (http://d2p2.pro/). Here, complementary disorder evaluations together with some disorder-related functional information are shown. The D2P2 database uses outputs of several disorder predictors (see differently colored bars at the top of the plot), such as ESpritz_DisProt, ESpritz_X-ray, and ESpritz_NMR (shown as ESpritz-D, ESpritz-X, and ESpritz-N, respectively), IUPred_long and IUPred_short (shown as IUPred-l and IUPred-s, respectively), PV2, PrDOS, PONDR® VSL2B, and PONDR® VLXT. This is complemented with the information on the location of domains predicted by Superfamily and Pfam platforms (http://supfam.org/SUPERFAMILY/ and https://pfam.xfam.org/, respectively). The level of agreement between all of the disorder predictors is shown in the middle of the plot as color intensity in an aligned gradient. The green segments represent disorder that is not found within a predicted domain, whereas the blue segments are where the disorder predictions intersect the domain prediction. Positions of disorder-based interactions sites (MoRFs) and sites of curated posttranslational modifications (phosphorylation) are also shown by yellow blocks with zigzag infill and by red circles, respectively.

    Two Kolmogorov-Smirnov two-sided tests (alpha = 0.01) [23] were applied, counting the rejections and matches generated by the PIM system. The first test compared the ATS non-redundant mutated proteins with the ATS non-redundant proteins.The second test compared ATS non-redundant mutated proteins with the BrS non-redundant mutated proteins. The Excel files with the protein sets, and the Kolmogorov-Smirnov tests can be found in the Supplementary Materials files.

    Figure 4 represents the disorder profile generated by the D2P2 platform for the normal human Kir2.1 protein (UniProt ID: P63252), mutations in which are associated with ATS. Since Kir2.1 protein is a multi-pass transmembrane protein, it was expected that its transmembrane region (residues 82–178), which covers transmembrane helices (M1 and M2, residues 82–106 and 157–178) and a regulatory segment (residues 107–156) containing the intramembrane pore-forming loop (H5 or P-loop, residues 129–147) connected to the M1 and M2 transmembrane helices via extracellular linkers (residues 107–128 and 148–156), would contain high levels of order, whereas the cytoplasm-located N- and C-terminal tails (residues 2–81 and 179–427, respectively) would possess noticeable levels of intrinsic disorder.

    This is in agreement with previous studies on transmembrane proteins, which identified a high prevalence of intrinsic disorder in the intracellular parts of transmembrane proteins [19,20,21]. In agreement with these expectations, Figure 4 shows that significant parts of the N- and C-tails are predicted to contain high levels of intrinsic disorder, whereas the central part of this protein is mostly ordered. Importantly, both disordered tails might be related to the regulation of the Kir2.1 functionality, since both of them contain phosphorylation sites (Y9, Y242, Y336, Y337, Y341, S342, Y366, and S425), and since two disorder-based protein–protein interaction regions (residues 366-381 and 406-416), known as MoRF, are located within the C-tail (Figure 4). Importantly, the vast majority of disease-related mutations in human Kir2.1 protein are located within its N- (C54F, R67W, D71V, and T75R) and C-terminal tails (P186L, N216H, R218W, G300V, V302M, T305P, and Δ314SY315), whereas the remaining mutations (V93I, Δ95SWLF98, and D172N) affect transmembrane helices M1 and M2. These observations indicate that the majority of the ATS-associated mutations in the Kir2.1 protein might affect regulation of the functionality of this protein.

    The graphs of the PIM profile (Figure 2) of the Kir2.1 protein and mutated proteins associated with ATS coincide only in the interaction [P, N] (X-axis), with the main differences between both graphs being located in the interactions on the X-axis: [P+, P+], [P+, P], [P+, N] and [P+, NP]. When comparing the PIM profile of ATS, disordered proteins, and CPP (Table 1, columns) among themselves and with the other groups (Table 1, rows), it was found that the PIM profile of the Kir2.1 protein and its mutated proteins associated with ATS are clearly distinct from other groups (Table 1, ‡ box). The same conclusion was achieved for the other protein groups evaluated in this study (Table 1, † box). When calibrating the PIM system with the PIM profile of CPP (with and without endocytic uptake mechanism), it was particularly observed that there were no coincidences with the proteins and mutated proteins associated with ATS (Table 1, Σ box). Also, when calibrating the PIM system with the PIM profile of completely disordered proteins and partially ordered proteins groups, it was observed that there were almost no coincidences with the ATS proteins and ATS mutated proteins (Table 1, @ box). When the PIM system was calibrated with the ATS mutated proteins and its PIM profile was compared with the PIM profile of 468939 "reviewed" proteins found in living organisms, and 9023 "reviewed" proteins found in humans from the UniProt database, we observed that (Table 2), there are 37 new proteins (Table 3, row 4)—a negligible number of proteins associated with ATS-associated in that database. These 37 proteins were explored further thorough a graphical analysis (Figure 3), which allowed to identify a subset of six proteins with very similar PIM profile: UniProt ID: A3NDB2, A3NZ22, A1V0A6, Q62H74, A2S5D5, and A3MPB8 (Table 3, row 4) in all "reviewed" proteins found in living organisms, and one protein found in humans (UniProt ID: Q9NZV8) from UniProt database (Table 3, row 3).

    The two statistical two-sided tests confirmed (with alpha = 0.01) that the proportion of proteins accepted/rejected by the PIM system does not correlate with the actual proportion of the groups of BrS mutated proteins and ATS mutated proteins, and the groups of ATS mutated proteins and ATS proteins. These results support the conclusion that the PIM profile of each one of these groups is different (Figure 2).

    In clinical practice, and we quote explicitly: "Since the culprit KCNJ2 gene was identified, locus heterogeneity has been shown in ATS. Kindreds without KCNJ2 mutations are clinically indistinguishable from those with mutations. Kir2.1 protein is an inward rectifier K+ channel with important roles in maintaining membrane potential and during the terminal phase of cardiac action potential repolarisation" [20]. From the bioinformatics viewpoint, it was observed that the PIM profile of the ATS mutated proteins is completely different from the PIM profile of the BrS mutated proteins (Table 1, ‡ box). Therefore, our data suggest that it is important to orient the computational algorithms to the group of mutated proteins associated with ATS. In fact, our results indicate that there are physicochemical variables that can be used to identify this syndrome.

    According to the PIM system, there was one protein found in humans [UniProt ID: Q9NZV8] (Table 3, row 3), and six proteins found in living organisms [UniProt ID: A3NDB2, A3NZ22, A1V0A6, Q62H74, A2S5D5, and A3MPB8], with PIM profile peculiarities very similar to those observed for the ATS-associated mutated forms of the Kir2.1 protein. This mutation penetrance value is high, noticeably exceeding values envisaged by this group (e.g., it surpasses, by a large margin, the prevalence of mutated proteins in the Brugada syndrome-associated, where 36 redundant proteins have 4,388 such redundant mutated proteins). Therefore, we consider prudent to search for some of these candidate proteins in subjects with ATS diagnosis. ATS is a rare condition consisting of ventricular arrhythmias, and periodic paralysis, affecting in the medium and long term to the carrier, i.e. it does not compromise the life of the carrier in the short term, in the way that serious respiratory tract infections, such as Ebola virus or H1N1 influenza would do. However, 16 disease-causing mutations (66 mutated forms according to the literature [13]) in a single protein is a high number. In this work, we conducted a bioinformatics analysis that enables a vertical and horizontal study of a syndrome that is little known.

    From a chemical point of view, the PIM system reveals a clear dominance of nonpolar–nonpolar amino acid interactions in the sequential composition of ATS proteins. A similar observation was also made in Brugada proteins. When inspecting the nonpolar amino acid groups with the PIM system, it can be observed that it is formed by aromatic (F, W) and aliphatic amino acids (A, V, L, I, P), which can contribute to both hydrophobic and Van der Waals interactions crucial for the protein's tertiary structure. Therefore, the sequential nonpolar–nonpolar dominance should be echoed in clusters of nonpolar domains in tertiary structures, entropically enforcing the stability of these proteins. It is interesting that this seems to be a common feature of mutated proteins associated with both ATS and BrS.

    The metric of the PIM system is fundamentally an incidence matrix of 16 interactions. This incidence matrix can be reinterpreted as a 16–pseudo vector dual to 0–pseudo vector over a Geometric algebra [24], and it would allow the construction of a bijection between incidence matrices and real numbers (scalar). An important quality of this algebra is that its geometric product ab = a∙b + a⌃b acts in any linear vector space—it is not the case of the Gibbs algebra [25], whose cross product a x b is restricted. Also this algebra can be programmed into parallel-processing architectures, and although the PIM system is a supervised program when large files are analyzed, e.g. the set of all "reviewed" proteins from UniProt database (Table 1). The PIM elapsed time on the computer is 24 hours, then the possible improvements that the PIM system can solve in the short term are, the parallel processing techniques to reduce the processing time—when a master–slave computational scheme is at play. The PIM system utilized in this study is based on this scheme. It would be very helpful if the identification of the mutated proteins in the blood sample of the carrier could be provided by a portable AArch64/A64 cluster, as this computational architecture is low-cost and would enable the analysis of hundreds of proteins with the PIM system in a matter of seconds. Another option would be to send the information to the "cloud", where a parallel processor (i.e. GPU-based cluster) could conduct the accelerated computation and deliver the answer back to the mobile architecture. A cloud-based solution could also be useful to centralize data and associate them with other geographical or temporal information that may help to study the disease from a population distribution perspective [26].

    In the long term, a portable microlaboratory is a step towards the personalized medicine, where a portable unit can be close to the patient but still have the capacity of the big laboratory infrastructure via the remote access. The identification of the number of mutated proteins associated with the ATS in a given carrier is potentially possible through portable microlaboratories that can access the "fingerprint" of the mutated proteins associated with the ATS (microarrays) online. In other words, it is not necessary for the portable microlaboratory to have its own microarray. Instead, this electronic unit can (through wireless communication) have access to a remote microarray database. This would reduce the production cost of these portable microlaboratories, making them accessible to a wider population. Miniaturization may follow the philosophy of other personalized medicine devices [27] and may conduct other analyses simultaneously.

    The efficiency of the Polarity Index Method® system aimed at the identification of Andersen–Tawil mutated proteins makes it a useful bioinformatics tool, which can be used as a first filter in the identification of this protein group, as well as other protein groups that the PIM system has identified [14].

    The authors thank Concepción Celis Juárez for proof-reading and an anonymous referee for helpful comments. Funding none.

    All authors declare no conflicts of interest in this paper.

    Copyright & Trademark. All rights reserved (México), 2018: Polarity Index Method®, PONDR® FIT, PONDR® VLXT, PONDR® VSL2, PONDR® VL3, and PONDR® VSL2-based predicted percentage of intrinsic disorder (PPID) values. Software & Hardware. Hardware: The computational platform used to process the information was HP Workstation z210—CMT—4 × Intel Xeon E3-1270/3.4 GHz (Quad-Core)—RAM 8 GB—SSD 1 × 160 GB—DVD SuperMulti— Quadro 2000—Gigabit LAN, Linux Fedora 27, 64-bits. Cache Memory 8 MB. Cache Per Processor 8 MB. RAM 8 Software: PONDR® FIT, Polarity Index Method®, PONDR® VLXT, PONDR® VSL2, PONDR® VL3, FoldIndex, IUPred, and TopIDP, as well as PONDR® VSL2-based values of.

    The test-files was supplied as support of the manuscript to the journal, but it can be requested from the corresponding author (polanco@unam.mx). The materials related to "Intrinsic disorder propensity in 16 unique ATS-related proteins", was supplied also as support of the manuscript to the journal.



    [1] B. M. Batubara, The problems of the world of education in the middle of the Covid-19 pandemic, BIRCI-J. Hum. Soc. Sci., 4 (2021), 450–457. https://doi.org/10.33258/birci.v4i1.1626 doi: 10.33258/birci.v4i1.1626
    [2] D. V. Parums, Long COVID, or post-COVID syndrome, and the global impact on health care. Med. Sci. Monitor., 27 (2021), e933446-1–e933446-2. https://doi.org/10.12659/MSM.933446 doi: 10.12659/MSM.933446
    [3] M. K. Hassan, M. R. Rabbani, Y. Abdulla, Socioeconomic impact of COVID-19 in MENA region and the role of islamic finance, Int. J. Islamic. Econ. Financ., 4 (2021), 51–78. https://doi.org/10.18196/ijief.v4i1.10466 doi: 10.18196/ijief.v4i1.10466
    [4] A. K. Patel, S. Mukherjee, M. Leifels, R. Gautam, H. Kaushik, S. Sharma, O. Kumar, Mega festivals like MahaKumbh, a largest mass congregation, facilitated the transmission of SARS-CoV-2 to humans and endangered animals via contaminated water, Int. J. Hyg. Envir. Heal., 237 (2021), 113836. https://doi.org/10.1016/j.ijheh.2021.113836 doi: 10.1016/j.ijheh.2021.113836
    [5] M. Škare, D. R. Soriano, M. Porada-Rochoń, Impact of COVID-19 on the travel and tourism industry, Technol. Forecast. Soc., 163 (2021), 120469. https://doi.org/10.1016/j.techfore.2020.120469 doi: 10.1016/j.techfore.2020.120469
    [6] S. Zondi, K. Ombongi, COVID-19, politics and international relations: hopes and impediments, Politikon-UK., 48 (2021), 157–158. https://doi.org/10.1080/02589346.2021.1913800 doi: 10.1080/02589346.2021.1913800
    [7] S. M. Sayyd, Z. A. Zainuddin, P. M. Seraj, A scientific overview of the impact of COVID-19 pandemic on sports affairs: a systematic review, Phys. Educ. stud., 25 (2021), 221–229. https://doi.org/10.15561/20755279.2021.0403 doi: 10.15561/20755279.2021.0403
    [8] C. Strong, F. Cannizzo, Pre-existing conditions: Precarity, creative justice and the impact of the COVID-19 pandemic on the Victorian music industries, Perfect. Beat., 21 (2021), 10–24. https://doi.org/10.1558/prbt.19379 doi: 10.1558/prbt.19379
    [9] S. Singh, R. Kumar, R. Panchal, M. K. Tiwari, Impact of COVID-19 on logistics systems and disruptions in food supply chain, Int. J. Prod. Res., 59 (2021), 1993–2008. https://doi.org/10.1080/00207543.2020.1792000 doi: 10.1080/00207543.2020.1792000
    [10] C. Elleby, I. P. Domínguez, M. Adenauer, G. Genovese, Impacts of the COVID-19 pandemic on the global agricultural markets, Environ. Resour. Econ., 76 (2020), 1067–1079. https://doi.org/10.1007/s10640-020-00473-6 doi: 10.1007/s10640-020-00473-6
    [11] M. Zuo, S. K. Khosa, Z. Ahmad, Z. Almaspoor, Comparison of COVID-19 pandemic dynamics in Asian countries with statistical modeling, Comput. Math. Method. M., 2020 (2020), 4296806. https://doi.org/10.1155/2020/4296806 doi: 10.1155/2020/4296806
    [12] W. Bo, Z. Ahmad, A. R. A. Alanzi, A. I. Al-Omari, E. H. Hafez, S. F. Abdelwahab, The current COVID-19 pandemic in China: an overview and corona data analysis, Alex. Eng. J., 61 (2022), 1369–1381. https://doi.org/10.1016/j.aej.2021.06.025 doi: 10.1016/j.aej.2021.06.025
    [13] M. Campolieti, A. Ramos, The distribution of COVID-19 mortality, Infect. Dis. Model., 7 (2022), 856–873. https://doi.org/10.1016/j.idm.2022.11.003 doi: 10.1016/j.idm.2022.11.003
    [14] Á. Briz-Redón, Á. Serrano-Aroca, The effect of climate on the spread of the COVID-19 pandemic: a review of findings, and statistical and modelling techniques, Prog. Phys. Geog., 44 (2020), 591–604. https://doi.org/10.1177/0309133320946302 doi: 10.1177/0309133320946302
    [15] I. Franch-Pardo, B. M. Napoletano, F. Rosete-Verges, L. Billa, Spatial analysis and GIS in the study of COVID-19. A review, Sci. Total. Environ., 739 (2020), 140033. https://doi.org/10.1016/j.scitotenv.2020.140033 doi: 10.1016/j.scitotenv.2020.140033
    [16] O. J. Peter, S. Qureshi, A. Yusuf, M. Al-Shomrani, A. A. Idowu, A new mathematical model of COVID-19 using real data from Pakistan, Results. Phys., 24 (2021), 104098. https://doi.org/10.1016/j.rinp.2021.104098 doi: 10.1016/j.rinp.2021.104098
    [17] A. I. Abioye, O. J. Peter, H. A. Ogunseye, F. A. Oguntolu, K. Oshinubi, A. A. Ibrahim, I. Khan, Mathematical model of COVID-19 in Nigeria with optimal control, Results. Phys., 28 (2021), 104598. https://doi.org/10.1016/j.rinp.2021.104598 doi: 10.1016/j.rinp.2021.104598
    [18] S. T. M. Thabet, M. S. Abdo, K. Shah, T. Abdeljawad, Study of transmission dynamics of COVID-19 mathematical model under ABC fractional order derivative, Results. Phys., 19 (2020), 103507. https://doi.org/10.1016/j.rinp.2020.103507 doi: 10.1016/j.rinp.2020.103507
    [19] U. I. Nwosu, C. P. Obite, Modeling Ivory Coast COVID-19 cases: identification of a high-performance model for utilization, Results. Phys., 20 (2021), 103763. https://doi.org/10.1016/j.rinp.2020.103763 doi: 10.1016/j.rinp.2020.103763
    [20] I. Rahimi, F. Chen, A. H. Gandomi, A review on COVID-19 forecasting models, Neural. Comput. Appl., (2021). https://doi.org/10.1007/s00521-020-05626-8 doi: 10.1007/s00521-020-05626-8
    [21] M. Fatima, K. J. O'Keefe, W. Wei, S. Arshad, O. Gruebner, Geospatial analysis of COVID-19: a scoping review, Int. J. Env. Res. Pub. He., 18 (2021), 2336. https://doi.org/10.3390/ijerph18052336 doi: 10.3390/ijerph18052336
    [22] R. Kulik, P. Soulier, Heavy-tailed time series, Springer Series in Operations Research and Financial Engineering, New York: Springer-Verlag, 2020. https://doi.org/10.1007/978-1-0716-0737-4
    [23] M. A. Kouritzin, S. Paul, On almost sure limit theorems for heavy-tailed products of long-range dependent linear processes, Stoch. Proc. Appl., 152 (2022), 208–232. https://doi.org/10.1016/j.spa.2022.06.021 doi: 10.1016/j.spa.2022.06.021
    [24] W. Zhao, S. K. Khosa, Z. Ahmad, M. Aslam, A. Z. Afify, Type-I heavy tailed family with applications in medicine, engineering and insurance, PLoS. One., 15 (2020), e0237462. https://doi.org/10.1371/journal.pone.0237462 doi: 10.1371/journal.pone.0237462
    [25] D. Bhati, S. Ravi, On generalized log-Moyal distribution: a new heavy tailed size distribution, Insur. Math. Econ., 79 (2018), 247–259. https://doi.org/10.1016/j.insmatheco.2018.02.002 doi: 10.1016/j.insmatheco.2018.02.002
    [26] Z. Li, J. Beirlant, S. Meng, Generalizing the log-Moyal distribution and regression models for heavy-tailed loss data, ASTIN. Bull., 51 (2021), 57–99. https://doi.org/10.1017/asb.2020.35 doi: 10.1017/asb.2020.35
    [27] A. Alzaatreh, C. Lee, F. Famoye, A new method for generating families of continuous distributions, Metron., 71 (2013), 63–79. https://doi.org/10.1007/s40300-013-0007-y doi: 10.1007/s40300-013-0007-y
    [28] Z. Ahmad, G. G. Hamedani, N. S. Butt, Recent developments in distribution theory: a brief survey and some new generalized classes of distributions, Pak. J. Stat. Oper. Res., 15 (2019), 87–110. https://doi.org/10.18187/pjsor.v15i1.2803 doi: 10.18187/pjsor.v15i1.2803
    [29] H. A. Jessen, T. Mikosch, Regularly varying functions, Publ. I. Math., 80 (2006), 171–192. https://doi.org/10.2298/PIM0694171H doi: 10.2298/PIM0694171H
    [30] E. Seneta, Karamata's characterization theorem, feller and regular variation in probability theory, Publ, I. Math., 71 (2002), 79–89. https://doi.org/10.2298/PIM0271079S doi: 10.2298/PIM0271079S
    [31] S. I. Resnick, Heavy tail modeling and teletraffic data: special invited paper, Ann. Stat., 25 (1997), 1805–1869. https://doi.org/10.1214/aos/1069362376 doi: 10.1214/aos/1069362376
    [32] M. V. Aarset, How to identify a bathtub hazard rate, IEEE. T. Reliab., 36 (1987), 106–108. https://doi.org/10.1109/TR.1987.5222310 doi: 10.1109/TR.1987.5222310
    [33] X. Liu, Z. Ahmad, A. M. Gemeay, A. T. Abdulrahman, E. H. Hafez, N. Khalil, Modeling the survival times of the COVID-19 patients with a new statistical model: a case study from China. PLoS. One., 16 (2021), e0254999. https://doi.org/10.1371/journal.pone.0254999 doi: 10.1371/journal.pone.0254999
    [34] H. M. Almongy, E. M. Almetwally, H. M. Aljohani, A. S. Alghamdi, E. H. Hafez, A new extended rayleigh distribution with applications of COVID-19 data, Results. Phys., 23 (2021), 104012. https://doi.org/10.1016/j.rinp.2021.104012 doi: 10.1016/j.rinp.2021.104012
    [35] G. M. Cordeiro, E. M. Ortega, S. Nadarajah, The Kumaraswamy Weibull distribution with application to failure data, J. Franklin. I., 347 (2010), 1399–1429. https://doi.org/10.1016/j.jfranklin.2010.06.010 doi: 10.1016/j.jfranklin.2010.06.010
    [36] A. S. Alghamdi, M. M. Abd El-Raouf, A new alpha power Cosine-Weibull model with applications to hydrological and engineering data, Mathematics-Basel., 11 (2023), 673. https://doi.org/10.3390/math11030673 doi: 10.3390/math11030673
    [37] A. S. Hassan, S. G. Nassr, Power Lindly-G family of distribution, Ann. Data. Sci., 6 (2019), 189–210. https://doi.org/10.1007/s40745-018-0159-y doi: 10.1007/s40745-018-0159-y
    [38] A. S. Hassan, S. G. Nassr, The Inverse Weibull generator of distributions: properties and applications, J. Data. Sci., 16 (2018), 723–742.
    [39] A. S. Hassan, S. G. Nassr, A new generalization of power function distribution: properties and estimation based on censored samples, Thail. Statiet., 18 (2020), 215–234.
  • This article has been cited by:

    1. Antonella Belfatto, Marco Riboldi, Delia Ciardo, Federica Cattani, Agnese Cecconi, Roberta Lazzari, Barbara Alicja Jereczek-Fossa, Roberto Orecchia, Guido Baroni, Pietro Cerveri, Modeling the Interplay Between Tumor Volume Regression and Oxygenation in Uterine Cervical Cancer During Radiotherapy Treatment, 2016, 20, 2168-2194, 596, 10.1109/JBHI.2015.2398512
    2. Jean-Jacques Kengwoung-Keumo, Competition between a nonallelopathic phytoplankton and an allelopathic phytoplankton species under predation, 2016, 13, 1551-0018, 787, 10.3934/mbe.2016018
    3. Urszula Foryś, Beata Zduniak, Two-stage model of carcinogenic mutations with the influence of delays, 2014, 19, 1553-524X, 2501, 10.3934/dcdsb.2014.19.2501
    4. Marek Bodnar, Monika Joanna Piotrowska, Stability analysis of the family of tumour angiogenesis models with distributed time delays, 2016, 31, 10075704, 124, 10.1016/j.cnsns.2015.08.002
    5. Antonella Belfatto, Marco Riboldi, Delia Ciardo, Federica Cattani, Agnese Cecconi, Roberta Lazzari, Barbara Alicja Jereczek-Fossa, Roberto Orecchia, Guido Baroni, Pietro Cerveri, Kinetic Models for Predicting Cervical Cancer Response to Radiation Therapy on Individual Basis Using Tumor Regression MeasuredIn VivoWith Volumetric Imaging, 2016, 15, 1533-0346, 146, 10.1177/1533034615573796
    6. A. Belfatto, M. Riboldi, D. Ciardo, A. Cecconi, R. Lazzari, B. A. Jereczek-Fossa, R. Orecchia, G. Baroni, P. Cerveri, Adaptive Mathematical Model of Tumor Response to Radiotherapy Based on CBCT Data, 2016, 20, 2168-2194, 802, 10.1109/JBHI.2015.2453437
    7. Urszula Foryś, Monika J. Piotrowska, Analysis of the Hopf bifurcation for the family of angiogenesis models II: The case of two nonzero unequal delays, 2013, 220, 00963003, 277, 10.1016/j.amc.2013.05.077
    8. Ishtiaq Ali, On the Numerical Solutions of One and Two-Stage Model of Carcinogenesis Mutations with Time Delay and Diffusion, 2013, 04, 2152-7385, 118, 10.4236/am.2013.410A2012
    9. Vsevolod G. Sorokin, Andrei V. Vyazmin, Nonlinear Reaction–Diffusion Equations with Delay: Partial Survey, Exact Solutions, Test Problems, and Numerical Integration, 2022, 10, 2227-7390, 1886, 10.3390/math10111886
    10. Andrei D. Polyanin, Vsevolod G. Sorokin, Reductions and Exact Solutions of Nonlinear Wave-Type PDEs with Proportional and More Complex Delays, 2023, 11, 2227-7390, 516, 10.3390/math11030516
    11. Larysa Dzyubak, Oleksandr Dzyubak, Jan Awrejcewicz, Nonlinear multiscale diffusion cancer invasion model with memory of states, 2023, 168, 09600779, 113091, 10.1016/j.chaos.2022.113091
    12. Andrei D. Polyanin, Vsevolod G. Sorokin, Exact Solutions of Reaction–Diffusion PDEs with Anisotropic Time Delay, 2023, 11, 2227-7390, 3111, 10.3390/math11143111
    13. А. Д. Полянин, В. Г. Сорокин, РЕШЕНИЯ ЛИНЕЙНЫХ НАЧАЛЬНО-КРАЕВЫХ ЗАДАЧ РЕАКЦИОННО-ДИФФУЗИОННОГО ТИПА С ЗАПАЗДЫВАНИЕМ, 2023, 12, 2304-487X, 153, 10.26583/vestnik.2023.286
    14. Ali Sadiq Alabdrabalnabi, Ishtiaq Ali, Stability analysis and simulations of tumor growth model based on system of reaction-diffusion equation in two-dimensions, 2024, 9, 2473-6988, 11560, 10.3934/math.2024567
  • Reader Comments
  • © 2023 the Author(s), licensee AIMS Press. This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0)
通讯作者: 陈斌, bchen63@163.com
  • 1. 

    沈阳化工大学材料科学与工程学院 沈阳 110142

  1. 本站搜索
  2. 百度学术搜索
  3. 万方数据库搜索
  4. CNKI搜索

Metrics

Article views(1817) PDF downloads(164) Cited by(3)

Figures and Tables

Figures(9)  /  Tables(6)

/

DownLoad:  Full-Size Img  PowerPoint
Return
Return

Catalog